dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|182414270|ref|YP_001819336.1| (Opitutus terrae PB90-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sulfate transporter [Opitutus terrae PB90-1]
Sequence length 606
Sequence
MSEEGSSSYFAFRPKLMDCLRGYSRDRFMSDLAAGITVGVVALPLAMAFAIASGVPPQAG
IFTAVVAGFIISALGGTRVNIGGPTGAFIVILYGIYAKYGAENLAICTIMAGVILFLMGF
ARLGSMIKFIPYPVTMGFTSGIAVLIFSTQIKDFLGLSVEKVPSEFMEKMMVLGEHLGTT
QWPTLVLALASLAIIIFWPKGWQRRVPGSIVALVVGTVAAMLLKLPVETIGSRFGDIPQA
LPAIQFPTIEWANLRNLIQPATTIALLAAIESLLCAVVADGMIDDRHDSNQELMAQGLAN
IAAPLFGGIAATGAIARTATNVKSGGRTPIAGIIHAITLLGIILVAAPLAKFIPLATLSA
VLVNVALNMGEWHNFARLPKWPRSDALVFLTAFGLTVIIDLTVAVEIGMVLAAVLFIKRV
SETSQITAVDEATETEGSHHSLVGKQIPERVMIYRMFGAFFFGAADKLESALRREKQEPD
VLILRMRKVMAIDATGLNALEDLYERLRRKGKSLVLSAPHTQPMFVMENAGFLERIGREN
VCPHIDAALERAREILGLPPVAMPKDPLEDERRRLQQARQELSSAIERADQALNPDGKPS
DEQAKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]