dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|167630092|ref|YP_001680591.1| (Heliobacterium modesticaldum Ice1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment methylase of chemotaxis methyl-accepting protein [Heliobacterium modesticaldum Ice1]
Sequence length 454
Sequence
MACGMAELQQLISERTGWRFDQSRRDNLLQVLQARMEAHGIADHEAYHRLLLDKGPAGTE
EWRRLIDAVTVGETFFFRDRGQFALLRERILPTLLAERRDKKALRLWSAGCSTGEEAYSL
AILVDELVGAAPGWTIDVIGTDINEASLHIARAGRYSEWSLRATSPERRQEHFRRVDPGR
GRRAGPVWEVDPAIRSLVQFYRLNLLDGPLPDRFAPVASTDLILCRNVFIYFRPEAIRQV
LTDFFRCLNPGGFLLTGHGELLGLEPGQALFSFEHLLFPEGHIWQKPVIPPPAPSSRGIP
PAAVTQPLPGALSPERQPDRIPFQPPMPAMPKRAQSALGQAPLLPRDLPPQKPAIANVAG
EAPKLSDLDRLRDKARDFANRREYDRAEACCRAVIAVNPLDSEVYYLLGLIRLEQGDWSG
AHAFFQKVLFLAPDHGPARIEMAHVRLLLKENDQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]