dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|167630525|ref|YP_001681024.1| (Heliobacterium modesticaldum Ice1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment chemotaxis protein CheR [Heliobacterium modesticaldum Ice1]
Sequence length 261
Sequence
MTVVGDEYEIFIKKVYAKSGLDLSNYKRPQMERRIRTLARSQGVNDLLSYFALIDRDAEQ
YRKFIDHLTINVSEFLRNPSQWEILTTKILPMLLKENPLLKVWSAGCSTGEEPYSLAMTM
LESRCDMRNKVLATDLDTEVLRKAQIGIYSDKSLANVSPQMVSRYFEPQGSGFHRVKDDL
KRHIRFRQHNLLKDDFESGFDLILCRNVVIYFTEETKSLLYKRFHNALRKGGILFTGSTE
QIFQARELGFGTAATFFYQKL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]