dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|170719669|ref|YP_001747357.1| (Pseudomonas putida W619)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cytochrome B561 [Pseudomonas putida W619]
Sequence length 183
Sequence
MQLRNSPSRYGVISIVLHWVVALAVFGLFGLGLWMVGLDYYSPWRKAGPDLHKSIGLVLL
AVMLVRVLWRLISPPPPAPANHGAFTRLAAKLGHLALYIGLFAVMVAGYLISTADGVGIP
VFGLFEVPALVSDLPDQADLAGVIHLWLAWGLVIFAVLHALAALKHHYIDRDATLVRMLG
RKA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]