dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|291299197|ref|YP_003510475.1| (Stackebrandtia nassauensis DSM 44728)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment endonuclease I [Stackebrandtia nassauensis DSM 44728]
Sequence length 267
Sequence
MGKEWMPMRRTRTLAALAGAAVGATALILVPLATAQGHDAYEPPDGYYDAVEGMTGEELK
AGLNDIISNNEQLSYDEARDALKETDADPADPSKVVLIYNGTSVPADDYDQWNREHVWAK
SHGDFGTDIGPGTDVHHLRPANAVVNSTRNNLDFDMGGEEVADAPGNFYDSDSFEPRDED
KGDVARMILYMAVRYEGEDSYPDLEPNDEVENNEKPLHGRLSVLKQWNEQDPPSDFEKNR
NEVIFEKFQKNRNPFIDHPEWVGEVWA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]