dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|291299997|ref|YP_003511275.1| (Stackebrandtia nassauensis DSM 44728)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Snas_2500 [Stackebrandtia nassauensis DSM 44728]
Sequence length 144
Sequence
MAWIIWLAVAVALGIAELFTLTFVLLMIGAGAAAASLAAALGSPVELQGLVFVVVSVLSL
IGIRPWAKKLRDNRSGPDAKIGLQALEGAEALVLERVDSQHGLIKVQGQEWTARSYDGKQ
VLEQGEEVNIVEIRGATAMVWRQP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]