dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|291301311|ref|YP_003512589.1| (Stackebrandtia nassauensis DSM 44728)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment class I and II aminotransferase [Stackebrandtia nassauensis DSM 44728]
Sequence length 548
Sequence
MTMMESGHHTARTEQKRLEGLSPFELKDSLISLADDHQKNTAMQMINAGRGNPNWIAVKP
REAFFLLGNFGIAESRRDWSEFEVLGGMPQKDGIAERFRAFLNSNADAPGADLLRDSLDY
GVNRLGFDADAFVHELADAVIGDQYPVPDRMLTHFEKVVHAYLVQEMCAGQAPAADYDLF
AVEGGTAAMCYIFDSCMTNKLLHKGDKIAIMSPIFTPYLEIPHLERYQFDVVELNATRVD
DQGFHTWQYPDSEIDKLADPGIRALFCVNPSNPPSVMLARESMDRIASIVNEKNPELTVI
TDDVYGTFVDGFRSLMSVIPKNTIGVYSFSKYFGCTGWRLGVIAVNQVNVFDERLATLPK
ADKQTLNERYGTLTLEPEKLRFIDRIVADSRQVALNHTAGLSLPQQTQMALFSLMALLDG
DDTYKSTCKAVIARRLEALTRGLGVDLPADPLAAHYYMELDLLSWAERHWGPEFATWMRE
NYEPVDPIFRLAEEDSVVLLNGGGFDGPEWSVRVSLANLPMAAYERIGKALWNIGQEYKR
AFDARKGG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]