dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|292489930|ref|YP_003532822.1| (Erwinia amylovora CFBP1430)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 1,4-alpha-glucan branching protein [Erwinia amylovora CFBP1430]
Sequence length 728
Sequence
MSELVDRRVINAVVSGHFADPFSLLGMHQTRLGLEVRALLPDASEVWVIETASGNKCVQL
KCLDARGFFHAVIPGRKKPFRYQLAVTWHGQQNLIDDAYRFGPLLPEMDGWLLAEGTHLR
PYETLGAHGDVIDGVSGTRFAVWAPNAQRVSVVGEFNYWDGRRHPMRLRREMGIWELFIP
GARNGQLYKFEMIDIHGQLRLKADPYAFEAQMRPQSASMICGIPEKTTLSPQRQRANGFD
APISIYEVHLGSWRRHTDNHFWLSYQELAQQLVPYAKEMGFTHLELMPVNEHPFDGSWGY
QPLGMYAPTRRFGTRDDFRAFITAAHQAGLNVLLDWVPGHFPTDDFGLAKFDGSELYEHG
DPREGFHQDWNTLIYNFGRREVSNYLAGNALYWIERFGIDGLRVDAVASMIYRDYSRAEG
EWVPNHFGGRENLEAIAFLRYTNRTLGHAAPGAITIAEESTDFNGVSRPPETGGLGFWFK
WDLGWMHDTLDYLKLDPIYRRHHHNLMTFGMLYSNTENFVLPLSHDEVVHGKGSILDRMP
GDAWQKFANMRAYYGWMFGFPGKKLLFMGNEFAQGKEWNHDTSLDWHLLEGEDGWHNGVQ
RLVRDLNHTYRAHPPLYQQDFDPAGFEWLVVDDFENSVFVFVRRDSDGNELIVASNFTPV
PRHDYRFGVSQAGRWREVLNTDSSHYHGSNIGNLGVVSTHDWGSHNRSHSLSLTLPPLST
LWLVREAE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]