dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|434382948|ref|YP_006704731.1| (Brachyspira pilosicoli WesB)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase [Brachyspira pilosicoli WesB]
Sequence length 369
Sequence
MRDTFETKSNIKLDEYYIQETSKDKSKVANKFVNNFKSNNKKQAAKYPKYYNKKTTYKKN
HNKLYHLKISISKIYDSTLPIRNFFNKIISAIMKKGNHERSILIFYNNEEKGLSLPINNF
MILFFVLIFASLIYTGFDAYYKQKEARDFYNTLSATEAKTYSLITEYKDSLNRYSKSLKD
YNDTIKNISYLIDYNNNSSFNNNSNNDNDINKTLNEIDRYQKNILTFMDVSSIIHKEIPV
GWPVAGGGRISSGFGARLSPFTQEKSYHYGVDIAGPYGTPILAAADGKVVFAGWKNGYGW
FVLIEHANGYQTGYGHNSELLVHGGQQVKRGQKIAMIGNTGRTTGIHCHFEVRIAGDHKN
PMPYLNARF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]