dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|284164669|ref|YP_003402948.1| (Haloterrigena turkmenica DSM 5511)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ATP-NAD/AcoX kinase [Haloterrigena turkmenica DSM 5511]
Sequence length 386
Sequence
MDSLGVVVNPIAGMGGRVGLKGTDGKLEEARRRGAEPRAPERAREALRSLHRRAPGVTVY
TAAGVMGERAVRDAGYEPIVVYEPTADDADLADATVSVDADTDPSDTSRPVDPATAETTA
ADTRAAVRAFLERDVDLVLFVGGDGTAVDVADVLEESEGDETPMLGVPAGVKIYSSVFAV
TPADAGRIAAEFDRAADREVNDIDEDAYREGEVRSQLEAIVPVPVAPDVQSSKQVSSGSV
DSLAAGFAREVDRERTYVFGPGSTVGAIERELEIDPSPLGVDVWRDGEVLARDAAESDIL
DVLEAPATIVVSPIGGQGFVFGRGNHQISPAVIERADEIEVVASGEKLDGIDALHVDTDD
EAIDEELRGWLRVRTGRFTTRLVKVV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]