dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|288957760|ref|YP_003448101.1| (Azospirillum sp. B510)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment methylenetetrahydrofolate reductase [Azospirillum sp. B510]
Sequence length 301
Sequence
MTAPISAPPSISFEFFPPKTEKMEQSLWQSIRRLAPLSPGFVSVTYGAGGSTRERTHATV
CRIQAETGIPAAAHFTCVGATRDEIDAIARTYWDAGIRHLVALRGDPPETAGGVGGKYEP
FPGGYAYAADLVAGMKRIADFEISVAAYPEAHPEAPSAQFDLDNLKRKIDAGATRAITQF
FFDNDVYYRFLDRCAAAGIHVPIVPGILPITNFARAVEFADRCGASMPAKLAETFEGLDD
DPETRQLVAATVAAEQCQELQARGVNDFHFYTLNRSDLTIAICRMLGVKAKAAPAAAPVA
G

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]