dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|406027059|ref|YP_006725891.1| (Lactobacillus buchneri)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Methionyl-tRNA formyltransferase [Lactobacillus buchneri CD034]
Sequence length 314
Sequence
MTTVVFMGTPQFAVPILQGLLDQKYDILCVVTQPDRPVGRKHRISQSPVKQAAVANHLPV
FQPEKLSGSPEMQRVIDFHPDLIVTAAYGQFLPTKMLNAVKIAAVNVHGSLLPKYRGGAP
VQYAIMNGDSETGISLIYMVKKMDAGDILAQKAVPIQPDDDTETMFDKLSIVGRDLLLAT
LPKVIAGDISPVPQDEDQVVFSPNIKPEEEQLDFNQTAFMVNAKVRALRPDPVAYTVING
KRTKIWGAQVVDQTTEMAPGSVVEKTKHQLLLSAGKGTVLSIQELQPAGKPKQQITDYLN
GIGQSLKVGQQVIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]