dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|385269769|ref|YP_005812929.1| (Chlamydia trachomatis A2497)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein [Chlamydia trachomatis A2497]
Sequence length 506
Sequence
MCLKLKQIQLCRTFVCLRHWMCFIGIGSLLLPTALRATERMRKEPIPLLDKQQSFWNVDP
YCLESICACFVAHRDPLSAKRLMYLFPQLSEEDVSVFARCILSSKRPEYLFSKSEEELFA
KLILPRVSLGVHRDYDLARVLVLAEPSAEEQKARYYSLYLDVLALRAYVERERLASAAHG
DPERIDLATIEAINTILFQEEGWRYPSKQEMFESRFSELAAVTDSKFGVCLGTVVLYQAV
AQRLDLSLDPVTPPGHIYLRYKDKVNIETTSGGRHLPTERYCECIKESQLKVRSQMELIG
LTFMNRGAFFLQKGEFLQASLAYEQAQSYLSDEQISDLLGITYVLLGKKAAGEALLKKSA
EKTRRGSSIYDYFQGYISPEILGVLFADSGVTYQETLEYRKKLVMLSKKYPKSGSLRLRL
ATTALELGLVKEGVQLLEESVKDAPEDLSLRLQFCKILCNRHDYVRAKYHFDQAQALLIK
EGLFSEKTSYTLLKTIGKKLSLVAPS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]