dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|289450816|ref|YP_003475282.1| (Clostridiales genomosp. BVAB3 str. UPII9-5)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PA domain-containing protein [Clostridiales genomosp. BVAB3 str. UPII9-5]
Sequence length 1871
Sequence
MKRILMKGSAILTALCMLTLCTEWPANVKADYDSAGAVWPNMPKSTVAAEATEHMLDTFI
CRLRGCGIIKSKEDLNNFGGAIPITIALHNETEAAGTQLDFIHLLGRRYQRIDEFMAKIA
KQIGREPVKIRKAALTNPMVATELTLKEIKSISKNKELERIEPDFPMLTTAHGFPAKTMI
RQNYSPINLGDIGNSSILYGAMSRNSRKSIFSDRAADIAFLPKLNGTGRVVAVLDTGFDI
DHPDFAMPDLTGAKYVDRESIIRRINEINSAAGTTLIRGGWLNNKFPYGYNYANNTFDVK
ESGNSHGTHVAAIAAASAGGKFPGQAPGAQIFAMRVLAGESDYAAPSVYAKAIEDSILLG
ADSINMSFGVPAATLKHAAAEILQAIATAKKMGVMVTVSAGNSNYADADLIPPQADNPNY
GTISSPALTPDVIAVASLDNSTVMLPYLNSGAAKIPYYPSSSRSLIDVYGKSLPLYDVGE
ATKDDLKDLPAKSLAGKAALIKRGKIKFDEKVAAVATLGAELAVIYDNESSGEWVNMGIN
NPAIPAIFLRKDDGLVLRKNGGSILLNKNQAAFKLTNGGKMSYFSSWGPTPEFDLKPELT
AVGGHVQAAQPGNTYGDKSGTSMAAPQVAGVAALLRERMLKDNDLSLDVQKTGATQLQNS
VAEGKNSVAVDNASYYRFAKNMLMSTATPQVDRKNNLFVSPRKQGAGLLNKEGVLTGYAY
VTSEIGESKLNLGNMASPIFNLPLVIHNCSKTKSLKFNIAQVTVQTDSLNPAHPQMIIPE
SSRRIVPDYHNDATIVVAPKSEYKFTIPIDISSLESELAKQFINGYFVEGFVRIKSLQPE
QGDIGLPYIGFRSGARNAGGGFIDLPVLERPIYEYEDLSENSAYTPKYYKLNQAKDKNAF
TALVSELNGKKVVLGETTTVPNKVRVFDKSKIAISPNGDGCQDYAELRGVFLLAYCEDKV
EITDEKGKVVFEGKDGYSGKADSNSANVGRKNMASTSDGTDADFYTEAERYKWYGKGRYG
EELPDGKYNYTFTVRGAAEAAKPQKYTFPIVVDRNKPEIVKPTLTSNGFAAEFVESGSGI
KTVRAETYDVDGKLLQVTIPKVSGNKLELSSSQDKLASTYLRLQDFAGNETFVAVKRLLA
GNDTGSLQVITTVKPLKPGESVDPLSSDEYEIIVKDSLGQRQMDTAALPYGKYTAEIKLK
ISNFVAVNKVENFTLTPTAKHAVLNFQVREVPTVKIDIPVDVSTDNGRMPNAERPIITAV
GTDGVVEEAEVKTSFSSAGNANTANFMLAAGKWQLTARRVPAGWRMLPEKVDIEVAGDGT
LSVINGSLPFTLIGPKVLGIEPQVEVLSGKLPMEKISYKAVVVGDKGKNKFAGHVFTDLS
ALPQGEYDVYPQLPKGFFAVPDVIRVDLRSEIAKPDLRIYAETEHDFGKIEVSENIDTKP
ASSPLADYVAINTNGEKFVDLHKLPYGTWLIKPRYTPQKFYTEQSEEKVILKPESKIAKV
VFNWMSFAASNKKGSVVLNPDWGFEWNLHNTFEKSSAKPYKYLFHRLDKPEQKDMTFELS
APSYYPPYTPVASDVPYGIYKVIPDTSATPNIFATPKSQIVRVSRTKSSIAFKYGNVEPK
ENKATIMENTSLGVKVILPENSALSGLKIKLVAEELNQVPSAVQAAYDKLPVKRKIYEIH
IVDEQGKVVPVPENEVWQVEIPRFYQEANAAAYYLSPNGYPIKPEQKVDNDLISMKVEHL
SVYAVAAGDMPQPKPEPQPKPEPQPKPEPQPQPEPQPNPNPNPQPKPDQEDQQPSSHSTS
EFDLYQKFFLSNASLKDREKGRQLNTRAGALPKTGEKGEKSVAPIMLIILGVALMVDLII
RKLQQIRRERS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]