dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|190571475|ref|YP_001975833.1| (Wolbachia endosymbiont of Culex quinquefasciatus Pel)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
Sequence length 1046
Sequence
MISSIQEPNELRKRLQGFYRTDEKSCVRYLVEKVELSVDSKNRIYNIAKQIVEKIRGSKL
GIIDSFIQQYSLSNDEGVALMCLAESLLRIPDDYTIDELIKDKIANQEWNKHLGRSSSLF
VNASTWSLIIGSSILRNNEEDSKFYNIISRLLKNLGEPIIRKAVKQAISILGKHFIVGET
IEKALESVKSDDYSKYLCSFDMLGESACTVEDAEEYFNLYMHAIKAIGESADINDCFKSQ
GVSIKLSSLHSRYEFSQFDNMAEELRTKVLELCHEAKKYNISLCIDAEESERLEMSLVLF
EQLRLDESLSEWEGLGLAVQAYQKRALSVLDFVEDVAIRSKHKVMVRLVKGAYWDSEIKR
TQELGLIGYPVFTRKSHTDVCYLACAQKLLSKENHFYPCFGTHNAYTFATIIELADKNHP
GFEFQRLHGMGKSLYDYAISELATSINCRIYAPVGKHSDLLPYLIRRLLENGANSSFVNQ
VNDSDVKIEELVSDPLEKVKSLEYEPHPSIPLPRDIFGEERKNSLGMDISDSIAVSQFAN
DVREFSEKKWQVGPIIDGESFLDSAEFTEVVNPAHLENVIGEVSSATSAHALNALEIAHS
AFTKWQNVSAEERAKCLEKAADLLEERMKELIYILIVEAGKILSDAIAEVREAIDFLRYY
AMIAKNELNDWKKLPGPTGEDNFIFFEGRGVFLCISPWNFPLAIFIGQVSAALAAGNAVL
AKPAEQTPIIAYEAVKILHEAGIPKNVLHLIPGDGWYLGKTLVPDNRISGVAFTGSTQTA
QIINRMLASRDGPIVPLIAETGGLNAMIVDSSALLEQVTKDVLISAFRSGGQRCSALRVL
FIQEDIAEKQVKMICNAAQELKIGDPIQLSTDIGPIIDKASIDMLTKHTEKISRDEDSNL
LFKVPMDTNSYNGYFFPPYIYEIQKISQLKQEVFGPILHIIRFNKSQLNEVISDINNTGY
GLTFSLQSRVQSQIALISKKISVGNVYINRNQIGAAVGTQPFGGRGLSGTGPKAGGPNYL
QRFSIEKVVSVNTTACGGNIKLACLD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]