dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|435850855|ref|YP_007312441.1| (Methanomethylovorans hollandica DSM 15978)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment uncharacterized protein involved in tolerance to divalent cations [Methanomethylovorans hollandica DSM 15978]
Sequence length 103
Sequence
MIIVVHTTTANMDEAKSIANALVEKGFAACVSMHPVTSVYKWKGNIEEEGEIELSIKTTS
EMLESVKKAIIYMHSYELPALIWWPVDGDEKYTEWIVDCVKPE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]