dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|194246751|ref|YP_002004390.1| (Candidatus Phytoplasma mali)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment 50S ribosomal protein L30 [Candidatus Phytoplasma mali]
Sequence length 61
Sequence
MKKPQFIIILNKSLIARTKSQIQTAHILGLRKINQKVIKDDNPVNRGMIRKIYHLVTIEK
L

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]