dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|427737397|ref|YP_007056941.1| (Rivularia sp. PCC 7116)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Riv7116_3954 [Rivularia sp. PCC 7116]
Sequence length 74
Sequence
MQKIVKVKPNSKKQEIIEEDDGSLTIRLKSPPVDGKANEELIKILSKKFNVPKSYIRIKS
GASSRQKLIEIDTD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]