dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

AMAG_05242T0 (Allomyces macrogynus ATCC 38327 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | AMAG_05242 | Allomyces macrogynus ATCC 38327 cryptochrome photoreceptor (569 aa)
Sequence length 568
Sequence
MPPATTNLARNVLMWFRRDLRLHDNPALLSALGQPDRIPAAQHLYPVYCLEIPTKKKCGH
RRWIFLLECLHDLDANLRKLGSRLFVVRGLAPDVLPLLVQHWNVSELAVGECHEPFAVAR
DNDVAQQIAPHGCDFKSFPGRTLFRPQDVLARTGNGKAPLTMAAFSKIAERLPVPTPVDA
PASLPSLGDDAITALRNALDPATFDALAGPQGDFSVPTIEPDGTVPELHLTTPIPAHEQS
PHRGGETEALRRLDAYLSDHARVTQFEKPKTSPAAFYPNADTTILSPYTTYGALSVRTFR
AGIDRVYRAAKGKHSKPPVSLLAQLYWREFFMTAGATTLNFEQMRRNPICLQTEWKCIPG
ETTRESHPDDYAMLDAWAEGQTGYPWIDAIMVQLRREGWVHHLARHSVACFLTRGDLYIS
WERGAEVFEDLLLDHEWALNRGNWMWLSASAFFHQYFRVYSPVKWGQSWDSEGVFIRKYL
PVLRKMPKQYIYEPWKAPIAVQRAAGCVVGVDYPKRIVDHDVVVKVNMTKMKTSHAAQRE
QAAMENGDSNGGRNGTRERSGNMRDRPL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]