dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ARB_06879 (Arthroderma benhamiae CBS 112371 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | Arthroderma benhamiae CBS 112371 hypothetical protein (1303 aa)
Sequence length 1302
Sequence
MGVPKFFRWLSERYPAISQLIAENRIPEFDCLYLDMNGIIHNCTHKDSDSPTFRMTEDKM
FIAIFNYIEHLFGKIKPKRLFFMAIDGVAPRAKMNQQRARRFRTALDAELAKEKAIKEGV
EMPKEDAFDSNCITPGTEFMAKLTKQLKYFINKKVSEDAEWQGVEVVLSGHEVPGEGEHK
IMEYIRQAKAQPEYDPNMRHCLYGLDADLIMLGLLSHDPHFCLLREEVTFGRQSQKKSKE
LEHQNFYLLHLCIVREYLELEFQELKLDGALQFPFDMERIIDDFILMAFFVGNDFLPNLP
NLHINEGALAWMFKVYKDVLPKLGGYVNEHGTINMERLRTLLTALSDVEFRFFEAEYSDA
RWLKSKTLDGDQTPTLPEKPNVLTITPAQKHIFNRIKKYVTHRPMDEAGQPVPLDLSPSL
PARDRKFVEQLADSLHLKWSSVLNQHEERFLRVQLPTNDDDDDEDDDDDESQIAILRVLK
KYENAKVKEVTAEDAQMAAEKKYEKKFQDWKDKYYKGKFGWGLENTEEMRKLTENYVQGL
QWVLFYYYRGVASWPWFYRYHYAPMISDIHLGLGADVDFKLGQPFFPFQQLMGVLPDRSK
KIVPVAFHGLMTSPDSPIIDFYPRDFELDMNGKKMEWEAVVKIPFIEEERLLKAMATKEH
LLTPEEKARNTFGVTLKFTYSPDVEFLYPSSLPGIFPDVSRCRCIENVFELPTMEGLDPY
VGLVEGVKIGAEALYGFPSLQTLQQTGQLGFHGVCVFQQESRNESMVVTISDPEIGGNTA
DAKTKLGKRVHVGYPFLQEAKVVCVSDELFDYVQVDGEEHVVPIPHTPTQISQWKKKAEK
IESYYSKRLGMVIGDVETIVRVEMLKGLKKTPDGATVKEFTEIPGVETEYAAQLIVDSVM
SEDLRFIEREAVPIEEEFPEGARAFFLGEYNYGAPVHVTGHEDGKLSGLLSAVKGKEPEF
GREHVLNAEKLSKYTPSFAIARNLRLSPLTLAKITSSFSVNMDGTRVNLGLNLKFEAKKL
KVLGYSRRGNSGWEFSERAIGLLQDYMIKFPDFIAGIQRKPQGDLFEPSDFYPADIAKEK
IKEIQAWLKSIESKSFERVPLEAEQLDSSIVQAIEKSADELSQSRPSPVAQKIRGVPRNA
LLKPADAEHRLNNQHFQLGDRVLYAQDSGKVPIASRGTVVGLTRTSRNLLLDVLFDVSFM
SGTTLSDRCSPFRGSTVPSSSVLNLTSKQLIALSRATAQNKEQAREQQLPLRATPRAMSG
MGQLKDAPTPPPLVNSYRGAATGQPSNGVTARRAAAVEEEAT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]