dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Aquca_011_00002.1|PACid:22037837 (Aquilegia coerulea v195)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 493
Sequence
MGRSNSPSFFKFLIHDSFNELRIPTAYIRHFNGDVPKKFILRSPTKRTWMVSAKENDNGV
FLCDEWRSFVKDNTLEFGDFLVFTYNGKSEFSVTIFGSDACEKVVPLTLKKDVESISHLK
DTTTSQVKEMDSPEKLHSGILQICPEKKRDDEAVVMDKMTSLPDSKPLNAERIEKLEATN
SFTVTFSPAKKYRIIIPRDLARENGLKQKDNVVLLDPCGRSWPVTIKHQRDRETTLTSGW
ANFRVANKINIGDTCLFEFIEGLGDALRVYIFRTSRKAPSGKQATAGMPISTYTPKGEIE
ALKRKGPRELINDRAAKYIKEERNPEEPQELPSSILYSVVQSNVSKTRMSKSAAISGRIK
KAPTRKPLESMSSRHAAAQEKERNIAMTASTSNKPFCSVTLRSTYVGSKSHNLVLPSRFA
KKYMKRAPRNVTLRDIDGGTWHALYIIGAHHKLVRGWNAFVLDNHLKEDDVCNFELVDGN
RNHYELKVSIDRS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]