dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

HMPREF0012_00700T0 (Acinetobacter calcoaceticus ruh2202)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | HMPREF0012_00700 | Acinetobacter calcoaceticus RUH2202 selenocysteine lyase (654 aa)
Sequence length 653
Sequence
MTTQLTTSNLQGSPTGPEVTGVNPPANFPDESTIARLANEFFSALPSSGNSASPSGLNLD
LPVGTPPHPPQPGEPFSALSGRAPNIAFQKSLNPEYPEHIPNLPDYPERRIVASAPVVGG
ANLPRPPFEPHLPQAVHSEPNVPRIEPNLPTDAGESPYYFLNDFSAPNTEEPSVKGVEDN
YSIAQSFQLPHGDQLKSLLIEDRFAADTPAKTSPSSGFYFLDLPQSGQSYSHYQPSQPTF
VASSAQPLDVHAIRRDFPILQERVNGRPLVWFDNAATTQKPQRVIDRIAYFYQHENSNIH
RAAHELAARATDAYEHARNVVARFIGAPSSKEIIFVRGTTEGINLIAKTWGEQNIGEGDE
IIVSHLEHHANIVPWYQLTKKTGAKLRVIPVDDTGQIILEELPKLINERTKLLSITQVSN
ALGTVTPVAEVIKIAHAKGVRVLVDGAQSVSHIPTDVQALDADFFVFSGHKVFGPTGIGA
VYAKPELLDTMPVWEGGGNMIQDVTFEQVVYQPAPNKFEAGTGNIADAVGLGAALEYVES
LGIHNIARYEHDLLEYGQNALSSVSGLRLIGTAHHKASVMSFTLQGYSTEQVGKALNQHG
IAVRSGHHCAQPILRRFGVEQTVRPSLAFYNTTEEIDLLVSVLHQLTRNKRTV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]