dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GSADVT00022662001 (Adineta vaga)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep supercontig:AMS_PRJEB1171_v1:HG381778:1784:5492:-1 gene:GSADVG00022662001 transcript:GSADVT00022662001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 1015
Sequence
MTGVEVFTEKCRDLLEIEREEEINQSTEALKGQPIKRLAERGLCLTRLHFQYTYTGLYGR
TILVFEGESLSRVQTFGPGDIAGIYQQGHSIDDQNPLARGLIFRLTTNTIHITIEDTDDE
QFNSLGDTCLFMIIKMANDVTYRRLKHGLTLMMKQRQGIAHHLLDIAFDNDDPIPSNFSQ
NTGPTQWFNENLDESQRDAVSFALASRDISIIHGPPGTGKTTTIVEYILQEALKRDAKIL
CCAPSNIAVDNLVERLGRKKQLKLIRLGHPARLLESIQCFSLESIVTENYQDVKNAIRED
LNLCFTKLRKSSIDRGERERLKNEIKHLRKDIRVYEEKASREAMKSVNVILCTLTSATDD
SPLKLLPPNHFDLVVIDECSQTLEVACWLALLRAPKCVLAGDHLQLPPTILSEKAAKDGL
AITLMQRLIEKFDDKITRMLTIQYRMNEAIMKWSSEEFYHGKLVADKSVRSHLLKDLANI
SKRDNEYEVDDENLSQCPLFLIDTTGYDMPEICFDDENSRGNEGEVALVNTHVKELVENY
GVSVDQIGVITPYNMQVQLLRRKLLNTYPTLEIKSVDGFQGREKEVIIISMVRSNLRGEV
GFLSDSRRINVAITRARRHLCVICNVQTVSHDPFMKRLIDYMLENGEVRSAFELVDDNNF
FQGAISSRKSTTSSKQTKQQTKKPKQQPKPRSEATNILENVLTNILDQRIDAFLKDHNAQ
RLQFEDDLSPFGRRYVHELAEKRNLQHISEGMDDQRHITIMKKSSNENATQPKIVKKVEK
EEEMTTQFRSFSVLEKEEKHSKLNKDKNITTTTTTKPQEETLHEDISSSEKTASPVLDLT
NLCRFCHKDIPPQNLQLHEIYCQRMNPLPSVSTTTNETSNIASSKLNVAAEHPKTVKKKS
NKLESLNSETSFDDLLEAARQQDNVCNAQRCKIKITLLGQLCSYCNRRYCFEHSMPEVHG
CGHQARTDIRQTHIATHSNVRPVYENSTINKDKRPYLERKLQDKINSKESQRKKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]