dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

EG:BRADI2G11640.3 (Brachypodium distachyon )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel chromosome:Brachy1.0:2:10002858:10005965:1 gene:BRADI2G11640 transcript:BRADI2G11640.3
Sequence length 427
Sequence
MECLSEVPHAPLDRRPRKRQRLGWDVGPEIPQIKFCGQEVANVISAVTLGLSSSGVVSSQ
VAEELLHVATPPLREDDKDGHYVFAVGDNLTSRYRINAKMGEGTFGQVLECWDRERKEMV
AVKIIRGIKKYRDAAMIEIGMLEQLCRYEKSRSSCVQIRNWFDYRNHICIVCEKLGPSLY
DFLRKNNYRSFPIAVVREVAKQLLECIAFMHELRLIHTDLKPENILLVSPEYIKVPDYKV
SSRSLKDGSYYKRLPKSSAIKVIDFGSTTYDQQDQSYVVSTRHYRAPEVILGLGWSYPCD
VWSVGCILIELCTGEALFQTHENLEHLAMMEWVLGPLPYNMLKRRDRQAEKYVRKGRLNW
PEGCASRESMKAVMKLPRLQNLVIQNVEHSAGDFIDLLEGLLRYDPDGRLTAQEALKHPF
MTERSER

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]