dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|488572047|ref|YP_007909846.1| (Bacillus sp. 1NLA3E)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ferredoxin--nitrite reductase [Bacillus sp. 1NLA3E]
Sequence length 539
Sequence
MAYEKIWADNPVLNKTELRKLQKDALRIFDDIPYYAQNGFSSIPTEEWDMFKWAGLYLQK
PKEDGYFMMRVCVPSGVLTNEQAIVLANIAKDYGRGVYDFTTRQAIQFHWLTIDQIPDIY
SRLESVGLSTAGACGDITRNIVGNSLAGIDPNELFDTRPIVKEVYDFFQFNEDFSNLPRK
FKISISSNVNNASNSEINCLSFVPAYKEINGERVAGFNVKVGGGLSAVPYLAETLDIFVT
TDKTLEVAIAITTLYRDHGYREKRHRARLKFLIADWGVEKFKEKLIELTGPLPEKGEDAQ
KDWNAGYFYGVHQQKQAGLNYIGANIPVGRLTPEDVIEFARISKKYGDGEIRNCNSQNIV
IPNIPDENVDAILKEAIFTKFPIAPNKIVGYAVSCTGSEYCNLALVETKNRMKTIAEQLD
EEISLDVPVRIHMVGCPNSCGQRNIADLGLHGVKSRNQDKKLVEAFEIYVGGTLNKEAKF
NEKLKGKVEADHLKQVVKELLQSFQDTKLPGELYADYVNRVGKDFIQEKLDSILSSVTV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]