dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Cd36_16050 (Candida dubliniensis CD36 )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment |||methylthioribose-1-phosphate isomerase, putative|Candida dubliniensis|chr 2|||Manual
Sequence length 424
Sequence
MSTTTRTLQAIKFDRNNIKLEILDQLLLPYSTTYIPITSIEDAFKAIKLMQVRGAPAIAI
VGAFSVVVEVSNYLKQSDSNRKTIENLNDSLDYLITSRPTAVNLANALNDIKQLLQEFND
TDIINEKIYQQIYDYAIALYDEDLANNKKIGENGLKYIINTLTEQNFKGPFSIMTICNTG
SLATSGHGTALGIIRSTYQALQKNNSKEEFWLDHIYPCETRPYNQGAKLTTYELDYEQIP
FTLICDNMVSSLINTLSDDDNKKPIKTNQISPVKFIIVGADRIVENGDTANKIGTFQLST
IANFFNNNKFIQQQLKSNTTKTTINKEIKFIVAAPKTTIDLNTKTGDDIVIEERPANELT
TLVGPLLNEAGDVGEKLTVGIATPGISVWNPAFDVTPHELIDSIVTEDPHVFTKDENGEF
NLIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]