dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Cucsa.141850.1|PACid:16963538 (Cucumis sativus v122)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 381
Sequence
MALDSNNGGEVGVDNSLQSICYKRGSLRLLDQRKLPLETVYLDIKDATDGWHAIRDMVVR
GAPAIAISAALALAAEVNNSAPFNGTPNDAASFIADKLDYLVSSRPTAVNLGDAAIKLKE
IVSRAAAISSEASSVFQAFIEAAEAMLEDDVASNKAIGLYGANYIRDQQKSLEKFSVLTH
CNTGSLATAGYGTALGVIRALHSAGVLERAYCTETRPFNQGSRLTAYELVHEKIPSTLIA
DSAAAALMKFGRVNAVVVGADRVAANGDTANKIGTYSLALCAMHHKIPFFVAAPLTSIDL
SLSSGEEIVIEERSPKELLNSRGGLGEQVAASGIAVWNPAFDVTPAHLICGIITEKGVIT
KAGSDSFNIKEFVQKTAGPSA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]