dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

clementine0.9_006518m|PACid:19274448 (Citrus clementina v165)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 554
Sequence
MDNQPGMLYFRRPCFFNIFSSNLSAECLKLPLQFVRHMEGRTSGSVTLIGPSWDTWHIDL
IQQDDNLFFDKGWPVFLRDNFIECGDLLVFRYDGELHFTVQIFDQSGCEKEAAFNSKSTS
TGQKREREEAVAHSDKALQSLLKKIRECSSSFESDCIDDNRDREADSCEETRRCLSLSTI
FASPSQPKTCNIKPEDEEKKVAQSFISAFPYFVRKMKRFNVSGSYTLNIPYQFSMAHLPN
FKTEVVLHNLKGASWTVNSVPTTKVHTSHTFCGGWLAFVRGNEIKLGDICIFELVHKCEL
HVYILRVGKQYPDSQRGTTVLTGSNVSSTTISCKQFDGVPKKVKKNSLKKIQLCNVKGSK
SCEIKKHIGTDGNSVSIATCCLPKISHEKSEAAAQNRNNVEAKMDSTPGGNLRTMMALDE
EKAARSFNSCVPHFVRIMRKFNISGSYTLKIPYKFAMAHLPDCKTEIVLRNLKGECWTVN
SLPDSKGRMVHTFCGGWMAFVRGNDIKIGDVCIFELISKLDMRVHITGVGRKEVDLESGK
LTSNESSTVDHPLF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]