dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|470177899|ref|YP_007563943.1| (Ilumatobacter coccineus)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pigment production hydroxylase [Ilumatobacter coccineus YM16-304]
Sequence length 383
Sequence
MMTHDDCIRAARNLAPLLSEKARDGEIARRPLDDVIEAARDSGLFSMMVPKRYGGHELDV
DTFFEVVLILSEADAAMGWLIGFYIEHAFWLAEYPEAVQDEAYGDADHVLAPAALNIAGG
TATPTDGGYLVNGRWSWGTGIVHATWVIAGCIAMDADGGATPMMFLLPRDEVDTIDTWHI
SGMCSTGSLDFTIDDVFVPEDRAVPFLGLLDGSWGIAARNDAPLYSTPLVPILALAAGLP
CLGAARGARAAFGEQVKEKIGATGMVKGEGNFGLIAEASLSIDAAELLMRDSLAKLLAHR
HDAGVDERSAWVSQIAHAVFMCRTATNTIASLVGASGAMLDNPIQRFARDINTASNHVVF
ERESRYGDHARQLFGQPITNQLV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]