dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

EPrPR00000024514 (Pythium arrhenomanes ATCC 12531 22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel supercontig:GCA_000387505.2:par_scaffold_4003:1059:2360:1 gene:maker-par_contig_4003-fgenesh-gene-0.0 transcript:EPrPRT00000024514 description:"Carbohydrate-binding protein."
Sequence length 433
Sequence
MPTACLQIAMVPLVLVIVLLGESLATAQSSTPAGYFSGEGTQYTLSYPTDGNCNFMSFPE
EAKTKYAALNKPQFKTTTNCGRCALVSCVDPTKCADAKQQSEIVHIVDQCPECVRGDLDL
SPKVFESITGLQSDRVKIQWKFVDCPVRGKIQYCLKDGSNPFWTAIQPTNFLVGVKSLQV
NGQDTTMVDSAYYFLKDGKSASQTDLTALKVTLTSVNGEVLEETISLAGGGCVESKFQFS
KDRAADSEADFNDQTQTENRDAGSVTQNTQSPTPAPSPSPVVTTPMPTTTTPPTPTTPTP
TRTPTQPSAPSLRGSNEAAVIVPTPETTSPAPPTTSAVPTNEAGVVRQVTTRSGDGAQPT
SPVLIILLVLACTCLFVLGVLALRVKYRRRLKRESQAAKRSIIHVSDLPRLIVKQSSYEE
LASPTQRADIAFL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]