dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|501680248|ref|YP_008000074.1| (Pseudomonas protegens CHA0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein PFLCHA0_c27990 [Pseudomonas protegens CHA0]
Sequence length 1664
Sequence
MRLVQLHPPVILLPLPETRSRMQHRPARGLHATLPSITSPSGVPQMAFFTAASKADFQHQ
LQAALAQHISEQALPQVALFAEQFFGIISLDELTQRRMSDLAGCTLSAWRLLERFDHGQP
QVRVYNPDYERHGWQSTHTAVEVLHHDLPFLVDSVRTELNRRGYSIHTLQTTVLSVRRGS
KGELLEILPKGTQGEGIQQESLMYLEIDRCANAAELSVLGKELEQVLGEVRVAVADFEPM
KAKVQELIQSIDNSQFPIAAEEKTEIKSFLEWLVGNHFTFLGYEEFVVGADQDGGHIEYD
PSSFLGLAKLLRAGLTSDDLRIEDYAVNYLREPTPLSFAKAAHPSRVHRPAYPDFVSIRQ
IDADGKVIKECRFMGLYTSSVYGESVRVIPYIRRKVEAIEQRSGFQAKAHLGKELAQVLE
VLPRDDLFQTPVDELFSTVMSIVQIQERNKIRVFLRKDPYGRFCYCLAYVPRDIYSTEVR
QKIQQVLMDRLQATDCEFWTFFSESVLARVQLILRVDPKQRIDIDPLLLEKEVVQACRSW
QDDYASLVVESFGEAHGTNVLADFPKGFPAGYRERFAAHSAVVDMQHLLSLTEANPLVMS
FYQPLGQVSGQRELHCKLYHADTPLALSDVLPILENLGLRVLGEFPYRLRHNNGREFWIH
DFAFTAAEGLDLDIQQLNDTLQDAFVHIVRGDAENDAFNRLVLTAGLPWRDVALLRAYAR
YLKQIRLGFDLGYIASTLNNHTDIARELTRLFKTRFYLARKLTSDDLEDKQQRLEQAILT
ALDDVQVLNEDRILRRYLDLIKATLRTNFYQTDANGQNKSYFSFKFNPHAIPELPKPVPK
FEIFVYSPRVEGVHLRFGNVARGGLRWSDREEDFRTEVLGLVKAQQVKNSVIVPVGAKGG
FLPRRLPLGGSRDEIAAEGIACYRIFISGLLDITDNLKDGALVPPANVVRHDDDDPYLVV
AADKGTATFSDIANGIAIDYGFWLGDAFASGGSAGYDHKKMGITAKGAWVGVQRHFRERG
INVQEDSITVVGVGDMAGDVFGNGLLMSDKLQLVAAFNHLHIFIDPNPDPATSFVERQRM
FALPRSAWSDYDTSIMSEGGGIFSRSAKSIAISPQMKERFDIQADKLTPTELLNALLKAP
VDLLWNGGIGTYVKASTESHADVGDKANDALRVNGNELRCKVVGEGGNLGMTQLGRVEFG
LNGGGSNTDFIDNAGGVDCSDHEVNIKILLNEVVQAGDMTDKQRNQLLASMTDEVGGLVL
GNNYKQTQALSLAARRAYERAAEYKRLMSDLEGRGKLDRAIEYLPTEEQLTERAATGKGL
TRPELSVLISYSKIDLKEALLKSLVPDDDYLTRDMETAFPPSLVAKFSEAMRRHRLKREI
VSTQIANDLVNHMGITFVQRLKESTGMSPANVAGAYVIVRDIFHLPHWFRQIEALDHQVS
AEVQLALMDELMRLGRRATRWFLRSRRNEQDAARDVAHFGPHLAALGLKLDELLEGPTRE
GWQARYTAYVEAGVPELLARMVAGTTHLYTLLPIIEAADVTGHDAAEVAKAYFAVGSALD
LPWYLQQISDLPVANNWQAAAREAFRDDVDWQQRAITIKVLQMADAPDDMEARVALWLEQ
NASMADRWRAMMVEIRAASGTDYAMYAVANRELLDLAMSGQSVL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]