dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|479184340|ref|YP_007810938.1| (Mycoplasma mycoides subsp. mycoides SC str. Gladysdale)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment conserved hypothetical protein [Mycoplasma mycoides subsp. mycoides SC str. Gladysdale]
Sequence length 180
Sequence
MSKLNLEKKLKIVKEAKKLNIKKSTYLANKYDISVDTVESLVNRFEVFGIEGLINKEKKP
YYSAKLKLKIVLYKLETNHSYDEVAKKFNIIYSSTIAGWVKKYREYGFLGLNNNIGRPKK
IMKNPNKKPAKIKKSQVKINNEQQIKELKEQVEYYKLEAEFWKKFHTLLTKEKSTRKKQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]