dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jCVI|EIN_065820 (Entamoeba invadens 1.2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_226:55212-55668(-) | length=139
Sequence length 139
Sequence
MVQSKSYKETLEANNTEINIADLEQQVQDLEERPVVTSNIDQTEVIKRDNQIADLEKAVA
ALKEQNTRLDAAKKDMKKQSVEDASKIKNYESQIKAFEAQKKMALDDKTEDEKTAADQSD
RRKKMEDQVKAFNAQVLSL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]