dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|410669544|ref|YP_006921915.1| (Methanolobus psychrophilus R15)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ATP phosphoribosyltransferase [Methanolobus psychrophilus R15]
Sequence length 290
Sequence
MISIALPKGSLEEQTYLLFKQADLEIKKTDRDYNPTIKDPRIGKIKILRPQEIPGYVSDG
YFDLGISGLDWVRESNADIMEVADLPYSKQGAGNVKIVIAVPKDSDIESAKDVKPGSRVA
SEYPNLTKKFFEDRGVPVDVHFSYGATEAKVPDLMDVVVDLTETGSTLRKNGLKIVDIIM
ESSSKLIANKKSWEDPVKRQEIEEIKTLLLSVIEARGKVLLDMNVPADKLDAVIESLPSM
KRPTVSQLYKSDYYAVETVVNKSEVNLLIPKLKALGAEDILEMDISKIVY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]