dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|488601559|ref|YP_007908030.1| (Archaeoglobus sulfaticallidus PM70-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment nitrogen regulatory protein P-II family [Archaeoglobus sulfaticallidus PM70-1]
Sequence length 110
Sequence
MKKIEAIIRPEKLECVKKALEESGYVAMTVTEVKGRGEQKGIKLQFRGREVDVDFLQKTK
IEIVAEDKDVDRIIDIITSSARTGKYGDGRIFVLPVEKSVKIRTGEEVSE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]