dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|389839520|ref|YP_006341604.1| (Cronobacter sakazakii ES15)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic protein [Cronobacter sakazakii ES15]
Sequence length 647
Sequence
MIKFSATMIATLVAASVNAATVDLRILETTDLHSNMMDFDYYKDAPTEKFGLVRTASLIK
AARQEAANSVLVDNGDLIQGSPLGDYMAAKGLKDGDVHPVYKALNTLDYAVGNLGNHEFN
YGLDYLHKALAGATFPYVNANIIDAKTQKPLFTPYLIKETQVKDKDGKPHTLKIGYIGFV
PPQIMTWDKANLSGKVTVNDITETARKYVPQMRAEGADLVVVVAHSGLSAEPYKAMAENS
VYYLSQVPGVDAILFGHAHAVFPGKDFAAIKGADIAKGTLNGVPAVMPGMWGDHLGIVDL
VLNNDSGKWKVTQSKAEARPIYDTQAKKSLAAEDPALVKVLKADHDATREFVSQPVGKSA
DPMYSYLALVQDDPTVQVVNNAQKAYVEHFIQGDPDLAQLPVLSAAAPFKVGGRKNDPAS
FVEVEKGQLTLRNAADLYLYPNTLVVVKATGAEVKAWLECSAGQFNQIDVNSTKPQSLLN
WDGFRTYNFDVIDGVNYQIDVTQPARYDGECQTINPKAERIKNLTFNGKPIDPNATFLVA
TNNYRAYGGKFADTGDSHIAFASPDENRAVLAAWIGAETKRAGEIHPAADNNWRLAPIAG
NHKLDIRFETSPSDKAAAFIKEKAQYPMTSVGKDDIGFAVYQLDLSK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]