dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|372487174|ref|YP_005026739.1| (Dechlorosoma suillum PS)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Holliday junction DNA helicase, RuvB subunit [Dechlorosoma suillum PS]
Sequence length 360
Sequence
MIETDSFDSSFDADAGRLIGAESKSAQEEAIERALRPKRLADYVGQAKIREQLSIFIHAA
KRRSEALDHVLLFGPPGLGKTTLAHIVAAEMGVNLRQTSGPVLERAGDLAAILTNLEPHD
VLFIDEIHRLSPVVEEILYPALEDFQIDIMIGEGPAARSVKLDLPPFTLVGATTRAGMLT
NPLRDRFGIVARLEFYNAQELTHIVTRSAQLLNVAIEPEGALEIARRSRGTPRIANRLLR
RVRDYAEVKADGIITREVADAALSMLDVDHGGLDLMDRKLLSAVIDKFAGGPVGVDNLAA
AIGEARDTIEDVLEPYLIQQGYLQRTPRGRIATPAIYRHLGLEAPGTPAATPDLWSPKEQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]