dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428224643|ref|YP_007108740.1| (Geitlerinema sp. PCC 7407)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment tRNA/rRNA methyltransferase SpoU [Geitlerinema sp. PCC 7407]
Sequence length 260
Sequence
MLTSLQNPLVKQLRKLQRTKERHQQQQILLEGTHLLEEAIAAGYPLLTVCFTESWQARYP
QLWPVVAQRTDRMELVSPAVLAAIATTVNPDGVVATIARQLPSPPDLPVQLGLVLETVQD
PGNLGTIIRTAAAAGVDGLWVSEDSVDLDHPKVLRATAGQWFRLPMGVSDRLPELIEAAR
AEGIQTIATVPSARLSYWELDFRQPSLLLVGNEGAGLSEDLMALADHQVQIPLSAGVESL
NVAIATSLVLYEAKRQREHP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]