dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428225744|ref|YP_007109841.1| (Geitlerinema sp. PCC 7407)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment formyl transferase domain-containing protein [Geitlerinema sp. PCC 7407]
Sequence length 224
Sequence
MSLQTVGLITYDYPHLKTEQILLRIVEKQYNYKMYALPFTPRKPREVLVQHRPDQTISIP
PEVLAQKFNIPYFRCNSDKDIDNSCDVYLVLGAGILSPECIAGKKVINCHPGIIPACRGL
DAFKWAILDMKPLGITLHFVDEAVDAGEIIAILPTNAFQSDSLETLARRHYENEIDICSR
FDELLENPVNSYKDIAVGNPRKRMSYEIEKTLSTALNQYLEQYG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]