dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

HGL_H00000290341 (Heterocephalus glaber v1.7-2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment IGF2BP1 (Homo_sapiens) insulin-like growth factor 2 mRNA binding protein 1
Sequence length 577
Sequence
MNKLYIGNLNESVTPADLEKVFAEHKISYSGPFLVKSGYAFVDCPDEHWAMKAIETFSGK
VELQGRRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETA
VVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQISQGPENGRRGGFGSRGQPRQG
SPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKAISVHSTPEGCSSACRMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK
KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEITKKVREAYENDVAAMSL
QSHLIPGLNLAAVGLFPASSSAVPPPPSSVSGAAPYSSFMQAPEQEMVQVFIPAQAVGAI
IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFF
GPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVVVKII
GHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]