dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

HGL_H00000351723-2 (Heterocephalus glaber v1.7-2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment NOL8 (Homo_sapiens) nucleolar protein 8
Sequence length 843
Sequence
MKANRETKRLFVGGLSQAISKTDLQNQFSRFGEVSDVEIITRKDDQGNAQKVFAYVNIRV
EADLKKCMSILNKTKWKGGTLQIQLAKESFLHRLAQEREEAKAEKEKSTRGKTNLSEKMG
GVDFHMKAVPGTEVPGHKNWVVSKFGRILPVLHLKNQPRPKISFVISLSVLFTMPLLCSL
TVGNIMKYDPSKYCHNLKKIREDFTNSIPITSLTWELEGGNEPMSKKRQREFSDCHDPLK
KIMKVQKSQGSTVSPRTSWVMENNILPQQQAEQKAPPDSITLSKSHLVLDSDAQKLKNIL
CQTSNLEAVRKRNSMDDDDIDSEDELRMILAKEENLQRTSCSSDNEESERDEKYKAMMKN
CPRINLTLADLEQLAGSNMGVPENTESSGPQSTTSCKFDRASKSPKAPRSIYTGKQCICP
EEILASLLREENMHGKQTTGSAKIHKIGFDKDNCHGTQQREEASEEEESDSSSNTSNVKP
PKYCPGEDTQEGMADFLLSLSNSLSMDAKAKPVEDNQKRLAALEARQKAKEAQKKLVHNA
LANLDGPPQDKLTHIIFGSDSESEMEEASTQKQNLPGELVKESKGKASGKLFDGEDKESD
SEDDSDRFKIKPLMDLQLHFGSDDRFQMDSRFLESDSEEEQEEVNEKKTAEEEELATEKK
KALNVVQSVLNINLNNTTSKGPVAAKKFKDIIHYPTSHDHITYERTKDDKPKESKAKWKK
REEAEKLPEVSKDMYYNIATDLKEIFQDTKDTTEKEKDKPRHKGCGREKNEEVHSVVALM
SGAEQPSEFMFSFFDSDSKNVKEGSDLFWRGVGSNISKNSWEARTNSLLMDCRKKHKEAK
KES

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]