dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

HGL_H00000416340-1 (Heterocephalus glaber v1.7-2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment HNRNPA3 (Homo_sapiens) heterogeneous nuclear ribonucleoprotein A3
Sequence length 282
Sequence
MEVKPPPGRPQPDSGRCRRHRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGT
LTNCAVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKVDGRVVEPKRAVSREDSVKPG
AHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKTETMEVMEDRQSGKKRGFAFATFDDHDTV
DKIVQKYHTINGHNREVKKALSKQEMQSAGSQRGCGGGSGNFMGHGGNFGGGRGNFGHGG
NFGGRGGYGGGGGCSRGSYGGVMVDIMDLEVMVGTVAVVLLQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]