dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|392425624|ref|YP_006466618.1| (Desulfosporosinus acidiphilus SJ4)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment sulfate permease-like transporter, MFS superfamily [Desulfosporosinus acidiphilus SJ4]
Sequence length 609
Sequence
MNLTRFRYIPIIGTLKNYKKEYFTKDLIAALTVAVVAIPQSMAYALIAGVNPVYGLYTAI
ISSILGSMFGSSKHLVTGPTNAICLLVAASMRNYMGLDNAYQMLFLMTLLVGALQMLYGI
IKLGKVINFVSHSVIVGFTAGAGVLIALGQLNTILSISIKNSAQLPTMEKLYYVLTHISQ
TNYYALGLGLLTIAIILICKKINKNLPGALIGIVIPILIIVMFGLDQKGVKLTGAIPSSL
PPFKMVQFSFDSLNKVFSGAVAISIIGLVEAISISKSIASTSRQKIDANQEFMGQGISNI
ISSFFQCFPSSGSFTRSAINYYNGAVTRMAAIMSGIVIAIVLLFFAPYAQYIPNPCLAGV
ILVTAYSLIDQEEIKRIVKLGKFSSDSLAMAITCLATILMPDLDYAIYSGIVISIILYLK
DTNKAPVRLFIPILEEDSRISRQELEVIDNKTDLLIIQLEGHLYFGSAFDLEQKLDNLVG
KAKLCILKMENVSSLDATAINALKIFIKSVKRYGGETIICGARPKINTILLKANLEKELE
RDYKFTLSEEEILNSVAITTENERTVLSCEKDNSVVNNFAYHLLQSVTNFNGGNSSNKKT
TYLENSSVN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]