dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|374995729|ref|YP_004971228.1| (Desulfosporosinus orientis DSM 765)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Desor_3209 [Desulfosporosinus orientis DSM 765]
Sequence length 141
Sequence
MTNEIFEKAQLLADAIARSEELAELHSKEDAMAADPSAQVLIAELQKAQERFMEAQQNGE
EPSEADKLAVDEIETKVEANPAIAAYMEAQDKFTEMLDGVNAILAGAIANASDSCSCGDS
GCDPSGCNPGGCGSSGCGCGA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]