dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|386340832|ref|YP_006037198.1| (Shewanella baltica OS117)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment peptidase M28 [Shewanella baltica OS117]
Sequence length 532
Sequence
MKNIILATSLMATISLPVLAETAFVQSLDLAQYRTDVKTLASDAFGGRAPLSEGETLTLD
YLVKAFKDMGLKPGFGDSYLQAVPLAQISADQNMQLDIGGLKFANGSEFTARTQRIAETV
SLNKSDVVFVGYGINAPEYGWNDYQGLDVKGKTVIVLVNDPGFATQDPAVFKGNAMTYYG
RWTYKYEEAARQGAEAVFIVHETAPAAYGWGVVQNSNTGTKFTLVDANNNQGQVGVMGWV
QHETAQKIFTKAGLDFDTLKQQAAKPNFKAIPLKLSAQLTLNNKIERAESHNVAALLPGK
TRPDEVVMMHAHWDHLGTVIEDGKSEILNGAVDNASGVAGVLALARYFKQQAKTAPLDRS
VLFSAFTAEETGLIGAQHFAQHPSVPTKNIVAFLNIDGMNVNKGVDYILRYGEDVSELEQ
YLDIAAKAQERSVKADPRPQNGLMFRSDHFALAQQGVPGLLFMSLGDTDPDYIAHKYHKP
ADDYDPSWNLGGVSQDLDLIASMITSLANSTDWPHWLESSDFKAKREQDGRK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]