dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Aurpu_var_sub1|696471|MIX1275_7_43 (Aureobasidium pullulans var. subglaciale EXF-2481 v1.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 364
Sequence
MPPIFKEPDLTAEDIARGDRHRTHGSPWVLFLRPRSDFDGSAWCTVHQNAWELVLKVLRF
ARTVDDAYYEAAMVAMRRWNADHAMSADPTHFLIYLEQQIQMEGGRLRENSYIWRAYSDC
NGPQTLTFSRFEDSSPTEPNLAVDETSAEFFLAETMLNYRLRSLAYISNEECKVELRLDR
RSLLGVPLTSPAMVMDATREAYTAVNKVIPNWLTLQLPAHLAPLSLSSPTPSHGRQTPSQ
GNPLGIIKRPHKCPFCRSCFSTEPRRDTHIQSVHGGQIALAAQQHATDQIPAAPTTSAPP
GCAPASDTPLGYAPASAIPWEYAPTSAIPLGPQSSATAEPEIGDEEETGPVEIVPHGSPD
SVQP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]