dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Pavirv00069271m|PACid:23768201 (Panicum virgatum v202)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 684
Sequence
MVFQKRSSSEMESCGGGQVAEMPRVPKSARGKRSVRKKEAQSSGQMMCAFDLLATVAGKL
LDEGEGSLGNMSAGAPALAACAKDVRVKQEQCDEAMKHFKHEVTDQDSCNESAIVPHTVF
SRSVNHVRNEDPKAKSEALGKESSMISCTKAELGCNFGAIADRWSPESVESGAFTGDAAA
SLMQVATVGFLKNAPDMYNLLDPMDVDVKPPPLVSSDSTGEMPLYGDKIRRSISLPRGPK
GVAGYAVDRDDDDDKSSGCTHPSTTTNRDFRPNCTADNSRVRKLLTSKYRKVAPARMHKS
DLSYSDVERKPSFRNKKMHYTRQRTQRSTFKRRKLFDRHAVLASEFGRANGKGNSKVTGR
DSHAASLEANKGTNSMPFQKSCASNDCHVKLRIKSFKVPELLVEIPESATVGSLKKTVLE
AVTAILGGGLRVGVLHHGKKVRDDSKTLMQAGIGQNDMLDNLGFSLEPNCTHNPSQVQAP
EDISFLETIDTTEPLARIAPADSSSKHGEVDVSQELALTPLAMNYQGSDHDSVHSPGGVS
SPDKVSTNSRALVPVPPADPNAGAVVPVNRSKRSPEQGQRRIRRPFSVAEVEALVLAVEK
LGTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELLDRVLAAQ
AYWSQQQAKLQPKTPPLAEARLLT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]