dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|456062685|ref|YP_007501655.1| (beta proteobacterium CB)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Extracellular ligand-binding receptor [beta proteobacterium CB]
Sequence length 394
Sequence
MNIRHHIFAVAAAAMLTTGAYAADIKLGVSGPFTGGSASMGVSMRDGVRLAAKEINAAGG
INGNKIVLVERDDEAKNERGVQIAQELINNEKVVATLGYINTGVALASQRFYQDAKIPVM
NNVATGSILTKQFPNAPENYVFRNAAPDNIQAPLIAKEAVEKRGLKRVAILADSTNYGQL
GREDLEKALKGYGVTPVAVEKFNIGDVDMTSQLLKAKNAGADVILTYAIGPELAQIANGM
AKLGWKKPMIGSWTLSMASFIDTAGKNGNGASMPQTYIQTPSTTAKRKAFQAAYLAEFKP
KNNNIASPVSAAQGYDSVYLLAAAIKQANSTEGPKIVAALQDLKTPVDGVVITYNKPFSA
TDHDAIKMKDVVMGVVENGRVEFLNAEDATPKKK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]