dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|347536013|ref|YP_004843438.1| (Flavobacterium branchiophilum FL-15)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Cytidine deaminase [Flavobacterium branchiophilum FL-15]
Sequence length 160
Sequence
MKDIITEVKFKAFEVMDELPAPIRDLMEKAIEARQRAYAPYSNFRVGAALLLENGVIVQG
SNQENAAYPSGLCAERVALFYAGAQYPGQKMVAFAISAASDTSVTDMPIPPCGACRQSIA
EYEIGQESPIQLYFMGAVGAIYQSDSLRNLLPFMFDKKYL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]