dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|392397508|ref|YP_006434109.1| (Flexibacter litoralis DSM 6794)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Flexibacter litoralis DSM 6794]
Sequence length 360
Sequence
MKIYLTPGPSENYFVVEEAIKEALQKKITAISHRSKEFKAIFGNTTNQLRELLEIPADFS
IAFTGSANEIWERILQSCVEKESFHLINGSFSKKFYHFAKQLNLNPSKYEVDFSKGFGVE
NINVPNSAELIAVIQNETSSGVQFPIENIAKIREKNKEKLIVVDAVSSLPYANLDFSIID
SVYFSVQKGFGVPAGLGVWIYNQKMVDKAKSLQEKGKSTGTYHSLLELDKYAQNNQTPET
PNVLEIFVLGKVIEAMNKKGIAMIRRETDYKAELLYHTLEQSEFLSPLITEKSQRSKTVI
VANVEKGTSSDVIAFLEKKGIIIGKGYGSFKDSQIRIANFPTHSKELMEQVADFLMEYGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]